Cancer & Apoptosis Research
Categories
- Bones and Joints Research00 products
- Cancer & Apoptosis Research22 products
- Cardiovascular Research11 product
- Cell Penetrating Research11 product
- Cell Repair and Regeneration Research11 product
- Cosmetic Peptides77 products
- Diabetes&Metabolism Research11 product
- Endocrine and Hormones Research33 products
- Gastrointestinal Research11 product
- Immunomodulation Research77 products
- Neuroscience Research1010 products
- products00 products

Sequence: Cys-Lys-Gly-Gly-Arg-Ala-Lys-Asp-Cys—Gly-Gly--(Lys-Leu-Ala-Lys-Leu-Ala-Lys)2
CAS: 62568-57-4
M.W: 2611.41 g/mol

Sequence: HDLDTDLDRDKDEDPDADSDEDIDADQDSDIDLDEDADYDSDQDNDGDWDADNDRDRDSDGDGDKDRDPDPDPDRDRDRDQDRDRDKDKDRDG-OH
CAS: 2460055-10-9
M.W: 5358.05
MOL Changes is a research and development organization specializing in the field of peptide science and is committed to providing multiple viable research avenues for the advancement of peptide science.
Get in Touch
- WhatsApp:+86 193 7515 8599
- Email:info@molchanges.com
- Mon-Fri 08:00 AM - 08:00 PM
- No. 58, Airport Avenue, Changsha
Services and products
© 2023 MOL Changes Biotechnology Co., Ltd. All Rights Reserved.