Cancer & Apoptosis Research

Adipotide (FTPP)

Adipotide

Sequence: Cys-Lys-Gly-Gly-Arg-Ala-Lys-Asp-Cys—Gly-Gly--(Lys-Leu-Ala-Lys-Leu-Ala-Lys)2

CAS: 62568-57-4

M.W: 2611.41 g/mol

Select options This product has multiple variants. The options may be chosen on the product page

FOX04-DRI

Sequence: HDLDTDLDRDKDEDPDADSDEDIDADQDSDIDLDEDADYDSDQDNDGDWDADNDRDRDSDGDGDKDRDPDPDPDRDRDRDQDRDRDKDKDRDG-OH

CAS: 2460055-10-9

M.W: 5358.05

Select options This product has multiple variants. The options may be chosen on the product page

MOL Changes is a research and development organization specializing in the field of peptide science and is committed to providing multiple viable research avenues for the advancement of peptide science.

Get in Touch

Services and products

Newsletter

Subscribe to our newletter

Facebook Twitter Instagram Telegram Youtube

© 2023 MOL Changes Biotechnology Co., Ltd. All Rights Reserved.